Bombyx BLAST Result against celegans

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= maV32578
         (639 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF068716-1|AAC17747.1|  247|Caenorhabditis elegans Hypothetical ...    28   4.9  

>AF068716-1|AAC17747.1|  247|Caenorhabditis elegans Hypothetical
           protein F26D11.4 protein.
          Length = 247

 Score = 28.3 bits (60), Expect = 4.9
 Identities = 14/44 (31%), Positives = 23/44 (52%)
 Frame = -3

Query: 499 VCFKLLI*QSCLLVPYSENISLLYRHRFVLFNNTIDITRDMTQN 368
           + FKLL+  SC  V      S L++ RF   +N +D   + T++
Sbjct: 26  ILFKLLLVASCFHVLVDSRKSHLHKRRFEASSNKVDDIEETTES 69


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 13,963,223
Number of Sequences: 27780
Number of extensions: 286837
Number of successful extensions: 766
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 720
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 766
length of database: 12,740,198
effective HSP length: 78
effective length of database: 10,573,358
effective search space used: 1416829972
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)