Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= maV31419
         (663 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ130951-1|CAA10260.1|  189|Anopheles gambiae SG3 protein protein.     24   3.7  
AY496420-1|AAS80137.1|  447|Anopheles gambiae bacteria responsiv...    23   8.6  

>AJ130951-1|CAA10260.1|  189|Anopheles gambiae SG3 protein protein.
          Length = 189

 Score = 24.2 bits (50), Expect = 3.7
 Identities = 6/9 (66%), Positives = 9/9 (100%)
 Frame = -1

Query: 582 QPWWSLPGL 556
           +PWWS+PG+
Sbjct: 81  RPWWSVPGI 89


>AY496420-1|AAS80137.1|  447|Anopheles gambiae bacteria responsive
           protein 1 protein.
          Length = 447

 Score = 23.0 bits (47), Expect = 8.6
 Identities = 8/31 (25%), Positives = 18/31 (58%)
 Frame = +2

Query: 272 HRCELVLIEIPVTYENVDEFVPALWETHTPK 364
           H  + + ++IP+  +N+D    A ++  TP+
Sbjct: 229 HVNQTIFLDIPLLKDNIDYVNVAAYDQQTPE 259


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 684,465
Number of Sequences: 2352
Number of extensions: 14973
Number of successful extensions: 13
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 66068490
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)