BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= maV31179
(556 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 25 0.68
AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8 ... 21 8.4
>AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha
protein precursor protein.
Length = 153
Score = 24.6 bits (51), Expect = 0.68
Identities = 11/30 (36%), Positives = 15/30 (50%)
Frame = -2
Query: 252 CIINENLKTIKNNVELKKCPNSHILRYCFC 163
C++NE K I E + P H L+Y C
Sbjct: 14 CLLNETAKAIIGVDECQATPVIHFLQYPGC 43
>AF080430-1|AAC28863.2| 208|Apis mellifera ribosomal protein S8
protein.
Length = 208
Score = 21.0 bits (42), Expect = 8.4
Identities = 8/13 (61%), Positives = 9/13 (69%)
Frame = +1
Query: 112 EGYHNEGSELNFY 150
+GY EG EL FY
Sbjct: 186 DGYILEGKELEFY 198
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 141,705
Number of Sequences: 438
Number of extensions: 2910
Number of successful extensions: 3
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3
length of database: 146,343
effective HSP length: 54
effective length of database: 122,691
effective search space used: 15949830
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -