Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= maV31167
         (506 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

02_02_0233 + 8105765-8107840                                           31   0.53 

>02_02_0233 + 8105765-8107840
          Length = 691

 Score = 31.1 bits (67), Expect = 0.53
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 4/64 (6%)
 Frame = -3

Query: 222 NYLYNH-YLINR*TTATRMKKGHVPPELESASESAKQVIER---HDRRKHWLVTHFSCHS 55
           NY+  H YL +R +TA  +  G +  +L S   S + V +    +DRR HW +    C+ 
Sbjct: 417 NYVNQHWYLEHRSSTAKII--GFIRKDLTSGWVSLRSVADHRRFNDRRGHWTLRREQCYG 474

Query: 54  HI*W 43
            + W
Sbjct: 475 ELGW 478


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,864,877
Number of Sequences: 37544
Number of extensions: 186552
Number of successful extensions: 381
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 375
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 381
length of database: 14,793,348
effective HSP length: 77
effective length of database: 11,902,460
effective search space used: 1083123860
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)