SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= maV31041
         (734 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Z32673-1|CAA83585.1|  472|Caenorhabditis elegans transcription f...    29   2.6  

>Z32673-1|CAA83585.1|  472|Caenorhabditis elegans transcription
           factor protein.
          Length = 472

 Score = 29.5 bits (63), Expect = 2.6
 Identities = 12/50 (24%), Positives = 28/50 (56%), Gaps = 1/50 (2%)
 Frame = -2

Query: 226 FLAHQLLETID-LKTRAASIFTAESSAILAVLDYIQLHNYDKWIIVTDSV 80
           F+ H +    D + ++   +  + S+  + +++Y+  H +DK+ +VTD V
Sbjct: 23  FIFHSITALCDHMLSKFVVVEVSNSNNTMTLVEYLVTHGFDKFAVVTDLV 72


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,109,498
Number of Sequences: 27780
Number of extensions: 324759
Number of successful extensions: 683
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 660
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 683
length of database: 12,740,198
effective HSP length: 80
effective length of database: 10,517,798
effective search space used: 1724918872
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -