BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30907 (666 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A5FL37 Cluster: Putative uncharacterized protein precur... 34 3.5 UniRef50_Q54PF4 Cluster: Putative uncharacterized protein; n=1; ... 33 8.2 >UniRef50_A5FL37 Cluster: Putative uncharacterized protein precursor; n=1; Flavobacterium johnsoniae UW101|Rep: Putative uncharacterized protein precursor - Flavobacterium johnsoniae UW101 Length = 144 Score = 33.9 bits (74), Expect = 3.5 Identities = 33/127 (25%), Positives = 54/127 (42%), Gaps = 2/127 (1%) Frame = +3 Query: 57 YAGIKFLISYELTVLYGLISAKSKSNRYTAKNIKHSRLGLFHRETETRLHITPSQIFASI 236 Y I +++ L VL +I K+K K +K + E + T S +F Sbjct: 11 YLFIMLVVTASLCVLAVIIKMKNKKG---PKLLKRDKYNSTMTEKMVEVKKTDSNVF--- 64 Query: 237 *VNITWDAAVRSQSHRQQSLPTKDKDTFTPIFRNINGRFKIILLYVEQKKR--STVAKPN 410 NI W R +S + S KD+D ++R+ + +F+ ILL E K S + Sbjct: 65 --NI-WPYVSRLKSAKILSKKIKDQDLIYKVYRDSSQKFEHILLSTEDKNNFVSIIVNKK 121 Query: 411 RGRALIY 431 R + + Y Sbjct: 122 RRKTIGY 128 >UniRef50_Q54PF4 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 64 Score = 32.7 bits (71), Expect = 8.2 Identities = 15/38 (39%), Positives = 23/38 (60%) Frame = +2 Query: 2 FFFFFSTHIYIYIEFVTVLCGNKIFNFI*ANSALWINF 115 FFFFF ++I+ EFV ++ N +NFI A ++ F Sbjct: 17 FFFFFFFLLFIFKEFVHLISANTYYNFICAPRQTFLFF 54 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 596,094,282 Number of Sequences: 1657284 Number of extensions: 11370268 Number of successful extensions: 23413 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 22761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23409 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 50826451017 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -