BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30907 (666 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1039.05c |||conserved fungal protein|Schizosaccharomyces pom... 31 0.15 SPAC637.09 |||ribonuclease H70 |Schizosaccharomyces pombe|chr 1|... 28 1.1 SPAPB8E5.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 28 1.4 SPAC15A10.10 |mde6||Muskelin homolog|Schizosaccharomyces pombe|c... 26 4.2 SPAC25G10.01 ||SPAC2C4.18|RNA-binding protein|Schizosaccharomyce... 25 7.4 SPBC9B6.04c |tuf1||mitochondrial translation elongation factor E... 25 9.8 SPAC6F12.17 |rna14||mRNA cleavage and polyadenylation specificit... 25 9.8 >SPAC1039.05c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 781 Score = 31.1 bits (67), Expect = 0.15 Identities = 17/46 (36%), Positives = 24/46 (52%) Frame = +1 Query: 286 NNHCLLKIKIHLHRYFETLMEDLKSYYYT*NRKKDLPLLSQIVDVL 423 NN C ++ +L + L E K + Y R K LPLL ++DVL Sbjct: 717 NNDCKSQLNAYLMQMRTGLSEKAKDHVYV--RSKTLPLLKCVIDVL 760 >SPAC637.09 |||ribonuclease H70 |Schizosaccharomyces pombe|chr 1|||Manual Length = 623 Score = 28.3 bits (60), Expect = 1.1 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 5/75 (6%) Frame = +1 Query: 298 LLKIKIHLHRYFETLMEDLKSYYYT*NRKKDLPLLSQIVDVL*YTNDE-----GANTSIT 462 LLK+K+ F +D +S ++ +R++ PL+ I D Y N E A+ S++ Sbjct: 417 LLKLKVKNGPAFGLFNQDFESIFHRLSRQQPTPLIGAIAD---YGNPESCIGKAAHKSVS 473 Query: 463 VTNNDFNFRLITRLS 507 N+D + LS Sbjct: 474 CANDDEVVSAVVSLS 488 >SPAPB8E5.08 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 103 Score = 27.9 bits (59), Expect = 1.4 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 14 FSTHIYIYIEFVTVLCGNKIFNFI 85 FS +IYIY F + LC +F +I Sbjct: 77 FSIYIYIYFFFYSFLCSPYLFKYI 100 >SPAC15A10.10 |mde6||Muskelin homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 716 Score = 26.2 bits (55), Expect = 4.2 Identities = 10/23 (43%), Positives = 17/23 (73%), Gaps = 2/23 (8%) Frame = +1 Query: 292 HCL--LKIKIHLHRYFETLMEDL 354 HCL + +++HLHR+ E + E+L Sbjct: 619 HCLSNVSLQLHLHRFHELVSENL 641 >SPAC25G10.01 ||SPAC2C4.18|RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 297 Score = 25.4 bits (53), Expect = 7.4 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +3 Query: 321 TPIFRNINGR-FKIILLYVEQKKRSTVAKPNRGRALIYERRR 443 T N+N + F +L V++ KRS P G+ + Y+RRR Sbjct: 156 TSAIDNLNSQEFYGRVLNVQKAKRSRPHSPTPGKYMGYDRRR 197 >SPBC9B6.04c |tuf1||mitochondrial translation elongation factor EF-Tu Tuf1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 439 Score = 25.0 bits (52), Expect = 9.8 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +1 Query: 340 LMEDLKSYYYT*NRKKDLPLLSQIVDV 420 LME + SY RK D+P L I DV Sbjct: 234 LMEAVDSYITLPERKTDVPFLMAIEDV 260 >SPAC6F12.17 |rna14||mRNA cleavage and polyadenylation specificity factor complex subunit Rna14|Schizosaccharomyces pombe|chr 1|||Manual Length = 733 Score = 25.0 bits (52), Expect = 9.8 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 Query: 287 LSVRLGADCSIPCYVHSNRSKD 222 LSVRL P +VH+NR D Sbjct: 610 LSVRLNGGNGFPGHVHNNREDD 631 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,609,385 Number of Sequences: 5004 Number of extensions: 52961 Number of successful extensions: 122 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 122 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 303841898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -