BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30907 (666 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014298-1773|AAF48168.2| 816|Drosophila melanogaster CG2559-PA... 30 2.5 AE014134-1243|AAF52488.1| 402|Drosophila melanogaster CG13783-P... 29 7.5 U63556-1|AAB58821.1| 789|Drosophila melanogaster larval serum p... 28 9.9 >AE014298-1773|AAF48168.2| 816|Drosophila melanogaster CG2559-PA protein. Length = 816 Score = 30.3 bits (65), Expect = 2.5 Identities = 16/52 (30%), Positives = 29/52 (55%) Frame = +1 Query: 337 TLMEDLKSYYYT*NRKKDLPLLSQIVDVL*YTNDEGANTSITVTNNDFNFRL 492 T+M+D+K +Y + +DL L ++ + +T D G N+ N D++F L Sbjct: 287 TMMKDVKKFYMPVDYSRDLYLYNEESKLSYFTEDLGWNSYWYYLNMDYSFFL 338 >AE014134-1243|AAF52488.1| 402|Drosophila melanogaster CG13783-PA protein. Length = 402 Score = 28.7 bits (61), Expect = 7.5 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +3 Query: 264 VRSQSHRQQSLPTKDKDTFTPIFRNINGRFKIIL 365 +R Q H+++ L ++K TP+ RNI + L Sbjct: 365 LRQQKHQKELLAMREKSRNTPLIRNIENEVSLAL 398 >U63556-1|AAB58821.1| 789|Drosophila melanogaster larval serum protein 1 beta subunitprotein. Length = 789 Score = 28.3 bits (60), Expect = 9.9 Identities = 15/52 (28%), Positives = 28/52 (53%) Frame = +1 Query: 337 TLMEDLKSYYYT*NRKKDLPLLSQIVDVL*YTNDEGANTSITVTNNDFNFRL 492 ++M+D+K +Y + +DL L ++ + +T D G N N D++F L Sbjct: 260 SMMKDVKKFYMPVDYNRDLNLYNKESKLSYFTEDLGWNAYWYYLNMDYSFFL 311 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,403,610 Number of Sequences: 53049 Number of extensions: 517381 Number of successful extensions: 931 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 860 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 931 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2868730650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -