BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30903 (711 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10) 190 1e-48 SB_20687| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 2e-12 SB_57614| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_5733| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_50221| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_39830| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_15102| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_3498| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_36505| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_27609| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 >SB_5032| Best HMM Match : COX1 (HMM E-Value=8.3e-10) Length = 229 Score = 190 bits (463), Expect = 1e-48 Identities = 91/149 (61%), Positives = 110/149 (73%) Frame = -3 Query: 628 IDIDTRAYFTSATIIIAVPTGIKIFR*LATIHGTQINYNPNIL*RLGFVFLFTVGGLTGV 449 +++DTRAYFT+AT+IIAVPTGIK+F LAT++G I + +L +GFVFLFT+GGLTGV Sbjct: 1 MNVDTRAYFTAATMIIAVPTGIKVFSWLATLYGGAIRLDTPMLWAIGFVFLFTIGGLTGV 60 Query: 448 ILANSSIDITLHDTYYVVAHFHYVLSXXXXXXXXXXXIN*YPLFTGLSLNSYILKIQFFT 269 ILANSS+D+ +HDTYYVVAHFHYVLS + TG N KI F+ Sbjct: 61 ILANSSLDVVMHDTYYVVAHFHYVLSMGAVFAIFAGFYFWFGKITGYCYNELYGKIHFWI 120 Query: 268 IFIGVNITFFPQHFLGLAGIPRRYSDYPD 182 +FIGVNITFFPQHFLGLAG PRRYSD+ D Sbjct: 121 MFIGVNITFFPQHFLGLAGFPRRYSDFAD 149 >SB_20687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 69.7 bits (163), Expect = 2e-12 Identities = 31/45 (68%), Positives = 34/45 (75%) Frame = -3 Query: 316 TGLSLNSYILKIQFFTIFIGVNITFFPQHFLGLAGIPRRYSDYPD 182 TG N KI F+ +FIGVNITFFPQHFLGLAG PRRYSD+ D Sbjct: 19 TGYCYNELYGKIHFWIMFIGVNITFFPQHFLGLAGFPRRYSDFAD 63 >SB_57614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 232 HFLGLAGIPRRYSDYPD 182 HFLGLAG PRRYSD+ D Sbjct: 1 HFLGLAGFPRRYSDFAD 17 >SB_5733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 232 HFLGLAGIPRRYSDYPD 182 HFLGLAG PRRYSD+ D Sbjct: 1 HFLGLAGFPRRYSDFAD 17 >SB_50221| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 232 HFLGLAGIPRRYSDYPD 182 HFLGLAG PRRYSD+ D Sbjct: 1 HFLGLAGFPRRYSDFAD 17 >SB_39830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 232 HFLGLAGIPRRYSDYPD 182 HFLGLAG PRRYSD+ D Sbjct: 1 HFLGLAGFPRRYSDFAD 17 >SB_15102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 232 HFLGLAGIPRRYSDYPD 182 HFLGLAG PRRYSD+ D Sbjct: 1 HFLGLAGFPRRYSDFAD 17 >SB_3498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 36.3 bits (80), Expect = 0.025 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 232 HFLGLAGIPRRYSDYPD 182 HFLGLAG PRRYSD+ D Sbjct: 1 HFLGLAGFPRRYSDFAD 17 >SB_36505| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 30.3 bits (65), Expect = 1.6 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = -3 Query: 649 HHIFTVGIDIDTRAYFTSATIIIAVPTGIKIFR*LATIHGTQINYNPNIL 500 HH+ T+ I + T+I PT I + + +H T IN +P ++ Sbjct: 14 HHLHTIIIHLHPTVIHLHPTVIFLHPTVIHLHPTVLNLHPTIINLHPTVI 63 >SB_27609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 707 Score = 29.9 bits (64), Expect = 2.1 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 2/43 (4%) Frame = -2 Query: 329 ISFIYRPFIKFLYTKNSIFYNIYWSK--YNIFSTTFFRFSWNT 207 + FIY + FL +KN F+ YW+ YN F W T Sbjct: 14 VGFIYVAKVVFLLSKNKSFFFEYWTPVVYNAFGQRSPNSRWRT 56 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,287,850 Number of Sequences: 59808 Number of extensions: 194423 Number of successful extensions: 312 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 287 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 311 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1877743452 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -