BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30901 (714 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 32 0.005 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 23 3.8 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 23 3.8 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 6.6 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 6.6 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 32.3 bits (70), Expect = 0.005 Identities = 19/43 (44%), Positives = 24/43 (55%) Frame = -3 Query: 169 SVYI*QAGLANHTISNNSYLQSASSLPMVRAATSDKPISPQNS 41 S Y+ Q GL + +S LQ LPM ++ TSD P S QNS Sbjct: 195 SQYLLQQGLGLQGHNPSSGLQPGEGLPMWKSDTSDGPESHQNS 237 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 22.6 bits (46), Expect = 3.8 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +1 Query: 73 SRHAPWVTTKQIEDNCCWRWYGWQDLL 153 ++H P T+ +ED GW +LL Sbjct: 249 AKHIPHFTSLPLEDQVLLLRAGWNELL 275 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 22.6 bits (46), Expect = 3.8 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +1 Query: 73 SRHAPWVTTKQIEDNCCWRWYGWQDLL 153 ++H P T+ +ED GW +LL Sbjct: 249 AKHIPHFTSLPLEDQVLLLRAGWNELL 275 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.8 bits (44), Expect = 6.6 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +1 Query: 85 PWVTTKQIEDNCCW 126 P + KQ D CCW Sbjct: 455 PGMIKKQQGDTCCW 468 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.8 bits (44), Expect = 6.6 Identities = 7/14 (50%), Positives = 8/14 (57%) Frame = +1 Query: 85 PWVTTKQIEDNCCW 126 P + KQ D CCW Sbjct: 545 PGMIKKQQGDTCCW 558 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,548 Number of Sequences: 438 Number of extensions: 4322 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22048515 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -