BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30895 (824 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1703.02 |rsc9||RSC complex subunit Rsc9|Schizosaccharomyces ... 27 2.4 SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|c... 25 9.9 >SPBC1703.02 |rsc9||RSC complex subunit Rsc9|Schizosaccharomyces pombe|chr 2|||Manual Length = 780 Score = 27.5 bits (58), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 68 VGCLVIKIKQIKRKNNLEYLNYCGLISNFVS 160 + L I+ K NNLE+L+YC IS +S Sbjct: 343 ISVLEASIRCAKTFNNLEFLHYCLDISEMIS 373 >SPAC2G11.09 |||DUF221 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 796 Score = 25.4 bits (53), Expect = 9.9 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = -1 Query: 425 VLFVYFIKVFYLGSQITSYFSHAGVRPSLTA 333 VLF YFI +F L +S S A +R S A Sbjct: 201 VLFTYFISIFLLYVLFSSTKSIADIRQSYLA 231 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,250,451 Number of Sequences: 5004 Number of extensions: 63821 Number of successful extensions: 112 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 112 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 404442380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -