BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30894 (749 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC343.13 |||glutamyl-tRNA amidotransferase|Schizosaccharomyces... 26 6.6 SPAPB17E12.07c |sen2||tRNA-splicing endonuclease subunit Sen2|Sc... 26 6.6 >SPAC343.13 |||glutamyl-tRNA amidotransferase|Schizosaccharomyces pombe|chr 1|||Manual Length = 526 Score = 25.8 bits (54), Expect = 6.6 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = +2 Query: 350 SEIHKSKNFYLSKEKQLEEYEMNGSESGFNPAFNIATIKQVVN 478 +E+H N +S EK + + G++ N++ ++ VVN Sbjct: 215 NELHFKNNGVISVEKSISHFPQLGTQLARVELKNLSNVRNVVN 257 >SPAPB17E12.07c |sen2||tRNA-splicing endonuclease subunit Sen2|Schizosaccharomyces pombe|chr 1|||Manual Length = 380 Score = 25.8 bits (54), Expect = 6.6 Identities = 12/33 (36%), Positives = 21/33 (63%), Gaps = 2/33 (6%) Frame = +3 Query: 78 YKKL*LFLNS--VILILN*VKNMSEFNQRWHEI 170 YKK +F ++ IL++ V N ++N +WHE+ Sbjct: 281 YKKGPVFSHAEFAILLIPCVGNKQKYNMQWHEV 313 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,676,244 Number of Sequences: 5004 Number of extensions: 49475 Number of successful extensions: 83 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 79 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 83 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -