Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= maV30893
         (738 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY187041-1|AAO39755.1|  272|Anopheles gambiae putative antennal ...    24   5.6  
AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript...    23   9.8  

>AY187041-1|AAO39755.1|  272|Anopheles gambiae putative antennal
           carrier protein TOL-1 protein.
          Length = 272

 Score = 23.8 bits (49), Expect = 5.6
 Identities = 12/31 (38%), Positives = 16/31 (51%)
 Frame = +3

Query: 327 ALPTAMYLFATKSEFLLTRALD*ENCIDFQT 419
           +LP A   F TK EF+ T   D  + +D  T
Sbjct: 28  SLPAASASFETKPEFIKTCRFDQPDFVDCST 58


>AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase
           protein.
          Length = 1022

 Score = 23.0 bits (47), Expect = 9.8
 Identities = 7/12 (58%), Positives = 11/12 (91%)
 Frame = +3

Query: 429 NYIKNKVLIYQT 464
           NY +N+VL+Y+T
Sbjct: 586 NYFRNRVLLYET 597


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 720,185
Number of Sequences: 2352
Number of extensions: 14241
Number of successful extensions: 11
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 75676146
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)