BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30893 (738 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 26 0.42 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 9.1 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 21 9.1 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 25.8 bits (54), Expect = 0.42 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 430 FQFYV*KSIQFSQSKALVNKNSDFVANKYIAV 335 F +Y+ Q+SQS + N+N DF ++V Sbjct: 335 FPYYMYSREQYSQSHLISNENRDFQTTPTVSV 366 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 9.1 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 324 YALPTAMYLFATKSEF 371 YAL TAM AT SEF Sbjct: 773 YALYTAMAPHATASEF 788 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.4 bits (43), Expect = 9.1 Identities = 11/49 (22%), Positives = 23/49 (46%) Frame = +1 Query: 544 DSIFDIFFQIMRFTNYSTSPYINTRGDLTIVQTTWHTGCLKQQAILELY 690 DS FF++++ S ++NT L+ + H + +++I Y Sbjct: 543 DSYIRSFFELLQNPKVSNEQFLNTAATLSFCEMI-HNAQVNKRSIHNNY 590 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 190,959 Number of Sequences: 438 Number of extensions: 4007 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -