BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30890 (702 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16A3.06 |||tRNA specific adenosine deaminase |Schizosaccharo... 26 4.5 SPAC3A11.14c |pkl1|klp1, SPAC3H5.03c|kinesin-like protein Pkl1|S... 26 4.5 SPBC28E12.03 |rga4||GTPase activating protein Rga4|Schizosacchar... 26 6.0 >SPBC16A3.06 |||tRNA specific adenosine deaminase |Schizosaccharomyces pombe|chr 2|||Manual Length = 388 Score = 26.2 bits (55), Expect = 4.5 Identities = 11/47 (23%), Positives = 26/47 (55%) Frame = +1 Query: 187 LRCSNQCITCILHCISHRHM*TERWLANIELHHEYSIHTECLIFFFI 327 LRC N+ + + HCI + + WL + + ++++++ LI ++ Sbjct: 95 LRCFNRLL--LEHCILIKESKKDTWLLEVADNGKFTLNSNLLIHLYV 139 >SPAC3A11.14c |pkl1|klp1, SPAC3H5.03c|kinesin-like protein Pkl1|Schizosaccharomyces pombe|chr 1|||Manual Length = 832 Score = 26.2 bits (55), Expect = 4.5 Identities = 8/31 (25%), Positives = 19/31 (61%) Frame = -1 Query: 408 VVQIPRAASNIFNEIYTEEVFTKNFHHDEEE 316 + Q+ R +++N++ EE+ + H+D +E Sbjct: 445 IQQLERRNEDMYNKLLAEEIIRRKLHNDIQE 475 >SPBC28E12.03 |rga4||GTPase activating protein Rga4|Schizosaccharomyces pombe|chr 2|||Manual Length = 933 Score = 25.8 bits (54), Expect = 6.0 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 4 LSLSWIELHMVCEFYYNRLS 63 L+LS + LH CE YNR S Sbjct: 442 LNLSQVSLHQACEPEYNRSS 461 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,671,148 Number of Sequences: 5004 Number of extensions: 51462 Number of successful extensions: 118 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 116 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 118 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 325165428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -