BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30885 (739 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 24 1.7 DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 22 5.2 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 5.2 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 6.9 AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive... 21 9.1 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = +1 Query: 115 LNHPKMEVEECVKEWEDLVADY 180 L + E E VKEW D V +Y Sbjct: 264 LTKDQPETYELVKEWRDFVDNY 285 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 22.2 bits (45), Expect = 5.2 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -3 Query: 590 NCSGLKSIYR 561 NCSG+ S+YR Sbjct: 118 NCSGITSVYR 127 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 5.2 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +2 Query: 233 ANCKQHV*RNWNTRNIAC 286 A CK + R WNT + C Sbjct: 763 AGCKCYNDRTWNTNAVDC 780 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.8 bits (44), Expect = 6.9 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 11/56 (19%) Frame = +1 Query: 289 IINAALKRLEKKGGVKDERV-----------TNLEKEIMKRKAMLHEIKATLPKQN 423 I++ R KKGG+KD + +N E EIMK +L+ + + N Sbjct: 176 IVSYPKSRSRKKGGLKDNLIPDKNDPDSKECSNQEYEIMKDNLLLYNHARLMSQDN 231 >AF004169-1|AAC13418.1| 371|Apis mellifera ultraviolet-sensitive opsin protein. Length = 371 Score = 21.4 bits (43), Expect = 9.1 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +1 Query: 532 AIAFILAVGNLYIDFRPLQLILIFLLVWYYC 624 ++ ++LA+ LYI F L L+ L++W +C Sbjct: 46 SLHYLLAL--LYILFTFLALLGNGLVIWIFC 74 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,842 Number of Sequences: 438 Number of extensions: 3732 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23023035 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -