BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30882 (666 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC543.02c |||DNAJ/TPR domain protein DNAJC7 family|Schizosacch... 26 4.2 SPBC23G7.08c |rga7||GTPase activating protein Rga7|Schizosacchar... 25 9.8 >SPBC543.02c |||DNAJ/TPR domain protein DNAJC7 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 476 Score = 26.2 bits (55), Expect = 4.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -2 Query: 629 RFKKNIPKKNGSIMNAYIYINILNMRKEIYL 537 R K ++PK I AY ++ILN E+YL Sbjct: 87 RIKPDVPKTQSRIRQAYEGLSILN-EAEVYL 116 >SPBC23G7.08c |rga7||GTPase activating protein Rga7|Schizosaccharomyces pombe|chr 2|||Manual Length = 695 Score = 25.0 bits (52), Expect = 9.8 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -2 Query: 596 SIMNAYIYINILNMRKEIYLLECKQ 522 +I+N+ + + ILN R + YLL CK+ Sbjct: 37 AILNSELGLAILNDRIKDYLLTCKE 61 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,262,777 Number of Sequences: 5004 Number of extensions: 40007 Number of successful extensions: 66 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 66 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 303841898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -