BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30880 (366 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.7 SB_39667| Best HMM Match : rve (HMM E-Value=9e-32) 26 8.1 >SB_48455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 622 Score = 27.1 bits (57), Expect = 4.7 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = +2 Query: 116 QPTNQANKSSSRIKTVLSQNLL 181 QP NQ NK+ RI+ L+Q+LL Sbjct: 387 QPRNQRNKTVVRIRLFLAQSLL 408 >SB_39667| Best HMM Match : rve (HMM E-Value=9e-32) Length = 1845 Score = 26.2 bits (55), Expect = 8.1 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = -1 Query: 183 ISKF*DNTVLMREDDLFAWLVGWSMPTLVVRI 88 +SK DN + + +DL A L G +P +VVRI Sbjct: 492 VSKL-DNYPIPKTEDLLAQLGGGGIPNVVVRI 522 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,572,703 Number of Sequences: 59808 Number of extensions: 92090 Number of successful extensions: 254 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 247 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 254 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 582596255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -