BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30880 (366 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41538-3|AAP31431.1| 142|Caenorhabditis elegans Hypothetical pr... 30 0.58 U41538-2|AAG00010.1| 997|Caenorhabditis elegans Hypothetical pr... 30 0.58 Z47070-2|CAA87343.2| 340|Caenorhabditis elegans Hypothetical pr... 28 2.4 AF125451-5|AAD12824.1| 1086|Caenorhabditis elegans Taf (tbp-asso... 26 7.2 U55364-13|AAM29677.1| 250|Caenorhabditis elegans Hypothetical p... 26 9.5 U55364-12|AAA97977.2| 260|Caenorhabditis elegans Hypothetical p... 26 9.5 >U41538-3|AAP31431.1| 142|Caenorhabditis elegans Hypothetical protein R04E5.8b protein. Length = 142 Score = 29.9 bits (64), Expect = 0.58 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 43 RTIHHNQDNIERRNHDSN 96 R+ HHNQD R+NHD N Sbjct: 102 RSRHHNQDRNRRQNHDRN 119 Score = 25.8 bits (54), Expect = 9.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 52 HHNQDNIERRNHDSN 96 +HNQD RNHD N Sbjct: 81 NHNQDRNRHRNHDGN 95 >U41538-2|AAG00010.1| 997|Caenorhabditis elegans Hypothetical protein R04E5.8a protein. Length = 997 Score = 29.9 bits (64), Expect = 0.58 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = +1 Query: 43 RTIHHNQDNIERRNHDSN 96 R+ HHNQD R+NHD N Sbjct: 946 RSRHHNQDRNRRQNHDRN 963 Score = 25.8 bits (54), Expect = 9.5 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = +1 Query: 52 HHNQDNIERRNHDSN 96 +HNQD RNHD N Sbjct: 925 NHNQDRNRHRNHDGN 939 >Z47070-2|CAA87343.2| 340|Caenorhabditis elegans Hypothetical protein T09B9.3 protein. Length = 340 Score = 27.9 bits (59), Expect = 2.4 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = -1 Query: 138 LFAWLVGWSMPTLVVRIVVAPLDVVLIMMDGSQCXLRRRPIEST 7 L A L ++ L +RIV+A L + I++ + C LRR P++ + Sbjct: 13 LIALLACLAIKFLALRIVLALLLTLPILLSVAFCVLRRSPVQES 56 >AF125451-5|AAD12824.1| 1086|Caenorhabditis elegans Taf (tbp-associated transcriptionfactor) family protein 2 protein. Length = 1086 Score = 26.2 bits (55), Expect = 7.2 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 179 VSFEIIQF*CEKTIYLLGWLVGQCQL 102 V EI+ CEK++Y L +G+C L Sbjct: 92 VRTEIVLLPCEKSLYQLDLHIGKCSL 117 >U55364-13|AAM29677.1| 250|Caenorhabditis elegans Hypothetical protein F21C10.3b protein. Length = 250 Score = 25.8 bits (54), Expect = 9.5 Identities = 10/23 (43%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = -3 Query: 100 SCSNRG--CAARCCPDYDGWFSV 38 SCS R C CC D++ WF + Sbjct: 179 SCSGRVDCCGMYCCHDFNQWFEL 201 >U55364-12|AAA97977.2| 260|Caenorhabditis elegans Hypothetical protein F21C10.3a protein. Length = 260 Score = 25.8 bits (54), Expect = 9.5 Identities = 10/23 (43%), Positives = 13/23 (56%), Gaps = 2/23 (8%) Frame = -3 Query: 100 SCSNRG--CAARCCPDYDGWFSV 38 SCS R C CC D++ WF + Sbjct: 179 SCSGRVDCCGMYCCHDFNQWFEL 201 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,983,694 Number of Sequences: 27780 Number of extensions: 69641 Number of successful extensions: 186 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 180 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 186 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 514188384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -