BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30878 (573 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_03_0199 + 16263549-16263644,16264941-16265899,16267140-162677... 28 6.1 >02_03_0199 + 16263549-16263644,16264941-16265899,16267140-16267791, 16267895-16267981,16268253-16268381,16269990-16270036, 16271337-16271438,16272720-16272843,16272981-16273028, 16273934-16274026,16274325-16274408,16274536-16274619, 16274751-16274819,16275531-16275590,16275946-16276017, 16276957-16277064,16278162-16278238,16278391-16278474, 16278617-16278728,16278778-16278810,16278811-16278900, 16279012-16279077,16279163-16279258,16279446-16279497, 16279723-16279775,16279998-16280018 Length = 1165 Score = 27.9 bits (59), Expect = 6.1 Identities = 10/35 (28%), Positives = 21/35 (60%) Frame = -2 Query: 281 LLDNEKKNSQLSHRYYSLRLLNNYITFKNRQYSVG 177 + ++ KN+ +S RY + L+N Y+ ++ Y +G Sbjct: 397 ITEDAVKNALMSPRYIDMNLINAYLARRSLDYLIG 431 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,055,819 Number of Sequences: 37544 Number of extensions: 254260 Number of successful extensions: 463 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 463 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1328870592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -