BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30878 (573 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g55840.1 68418.m06958 pentatricopeptide (PPR) repeat-containi... 31 0.72 >At5g55840.1 68418.m06958 pentatricopeptide (PPR) repeat-containing protein low similarity to fertility restorer [Petunia x hybrida] GI:22128587; contains Pfam profile PF01535: PPR repeat Length = 1274 Score = 30.7 bits (66), Expect = 0.72 Identities = 22/86 (25%), Positives = 40/86 (46%), Gaps = 3/86 (3%) Frame = -2 Query: 311 MSKSL*FTVTLLDNEKKNSQLSHRYYSLRLLNNYITFKNRQYSV---GLETNHTITFTGG 141 M KS+ + + +D + + +R LRL++ + K ++ V GLET+H + Sbjct: 19 MEKSI-YNILTIDRWGSLNHMDYRQARLRLVHGKLALKFLKWVVKQPGLETDHIVQLVCI 77 Query: 140 RTXL*VRAGRYHHRAYFCREAVMRFG 63 T + VRA Y + +E + G Sbjct: 78 TTHILVRARMYDPARHILKELSLMSG 103 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,362,198 Number of Sequences: 28952 Number of extensions: 209511 Number of successful extensions: 393 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 393 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1112061928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -