BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30875 (680 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47201| Best HMM Match : SAM_1 (HMM E-Value=7.1e-09) 29 2.6 SB_44668| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-05) 29 4.6 SB_21734| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.0 >SB_47201| Best HMM Match : SAM_1 (HMM E-Value=7.1e-09) Length = 765 Score = 29.5 bits (63), Expect = 2.6 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 1/58 (1%) Frame = +1 Query: 121 VRTSEIEYPEPGQQNFAYISAIYVKDHYTDGNGGYPIVK-SGGVGQKFVKLKLKSQRG 291 +R+S E P PGQ + +S+ VKD N G + SG + Q + LKS +G Sbjct: 499 LRSSSTETPHPGQSKPSLLSSQLVKDPPQSANTGKIMQSLSGFIVQASLHACLKSVKG 556 >SB_44668| Best HMM Match : 7tm_1 (HMM E-Value=6.1e-05) Length = 1604 Score = 28.7 bits (61), Expect = 4.6 Identities = 17/38 (44%), Positives = 18/38 (47%) Frame = +3 Query: 21 LQRPKPRPKSRPADLPRHRLVQDQRIQIRLPVHCPNER 134 L+RP P P DLP R V RLP H P ER Sbjct: 352 LERPVPAVTRLPTDLPLERPVP---AVTRLPTHLPLER 386 >SB_21734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.9 bits (59), Expect = 8.0 Identities = 12/34 (35%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +3 Query: 12 AVGLQRPKP-RPKSRPADLPRHRLVQDQRIQIRL 110 A+G +R P +PK+R + P ++ ++R +IRL Sbjct: 15 AIGFERLHPHKPKTRVKEYPTYKTATEKRTRIRL 48 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,658,818 Number of Sequences: 59808 Number of extensions: 321379 Number of successful extensions: 884 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 771 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 880 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1757375282 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -