BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30875 (680 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein pr... 24 1.5 Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP... 23 2.7 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 8.2 >DQ011227-1|AAY63896.1| 484|Apis mellifera Amt-1-like protein protein. Length = 484 Score = 23.8 bits (49), Expect = 1.5 Identities = 13/53 (24%), Positives = 24/53 (45%) Frame = +1 Query: 10 LLSACSAQSHDLSLGQLTYRDIVLYKINEYKYGFPFIVRTSEIEYPEPGQQNF 168 L S C + +++++ DIVL + + +GF T ++ P G F Sbjct: 51 LESGCVSLKNEVNIMMKNVVDIVLGGLTYWAFGFAMSFGTDKLNNPFIGMGEF 103 >Z26319-1|CAA81228.1| 464|Apis mellifera royal jelly protein RJP57-2 protein. Length = 464 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/49 (20%), Positives = 20/49 (40%) Frame = +1 Query: 70 DIVLYKINEYKYGFPFIVRTSEIEYPEPGQQNFAYISAIYVKDHYTDGN 216 ++ L +++ YG T + Y P +N Y++ + GN Sbjct: 242 NLTLKEVDNKVYGMALSPVTHNLYYNSPSSENLYYVNTESLMKSENQGN 290 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.4 bits (43), Expect = 8.2 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 37 HDLSLGQLTYRDIVLYKINEYKYGFPFIVRT 129 ++L LG +RD V + ++K G P + T Sbjct: 186 NNLPLGLEVWRDKVFITLPKWKDGIPVTLTT 216 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 155,742 Number of Sequences: 438 Number of extensions: 3612 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -