BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30875 (680 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g51910.2 68418.m06440 TCP family transcription factor, putati... 28 6.6 At5g51910.1 68418.m06439 TCP family transcription factor, putati... 28 6.6 At1g74310.1 68414.m08605 heat shock protein 101 (HSP101) identic... 28 6.6 At3g12050.2 68416.m01497 Aha1 domain-containing protein contains... 27 8.7 At3g12050.1 68416.m01496 Aha1 domain-containing protein contains... 27 8.7 >At5g51910.2 68418.m06440 TCP family transcription factor, putative similar to PCF2 [(GI:2580440) Oryza sativa] Length = 293 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 27 RPKPRPKSRPADLPRHRLVQDQRIQIRLPVHC 122 + KP PK RP RH V+ + +IR+P C Sbjct: 47 KTKPAPK-RPTSKDRHTKVEGRGRRIRMPAGC 77 >At5g51910.1 68418.m06439 TCP family transcription factor, putative similar to PCF2 [(GI:2580440) Oryza sativa] Length = 293 Score = 27.9 bits (59), Expect = 6.6 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = +3 Query: 27 RPKPRPKSRPADLPRHRLVQDQRIQIRLPVHC 122 + KP PK RP RH V+ + +IR+P C Sbjct: 47 KTKPAPK-RPTSKDRHTKVEGRGRRIRMPAGC 77 >At1g74310.1 68414.m08605 heat shock protein 101 (HSP101) identical to heat shock protein 101 GI:6715468 GB:AAF26423 from [Arabidopsis thaliana] Length = 911 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/39 (30%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Frame = +3 Query: 81 VQDQRIQIRLPVHC-PNERDRISGARSAELRVHIRDIRE 194 ++ +R+Q+ + +H E+D+ S AR E+R + D+R+ Sbjct: 416 LERKRMQLEIELHALEREKDKASKARLIEVRKELDDLRD 454 >At3g12050.2 68416.m01497 Aha1 domain-containing protein contains Pfam PF05146: Aha1 domain; similar to Protein C14orf3 (HSPC322) (Swiss-Prot:O95433) [Homo sapiens] Length = 321 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 214 NGGYPIVKSGGVGQKFVKLKLKSQRGHGFNFTVTIYGKY 330 +G P+V + V K VK K K++ GF T+T+ K+ Sbjct: 156 SGAAPVVSAAAVESKVVKEKKKAKTKEGFK-TITMTEKF 193 >At3g12050.1 68416.m01496 Aha1 domain-containing protein contains Pfam PF05146: Aha1 domain; similar to Protein C14orf3 (HSPC322) (Swiss-Prot:O95433) [Homo sapiens] Length = 360 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 214 NGGYPIVKSGGVGQKFVKLKLKSQRGHGFNFTVTIYGKY 330 +G P+V + V K VK K K++ GF T+T+ K+ Sbjct: 195 SGAAPVVSAAAVESKVVKEKKKAKTKEGFK-TITMTEKF 232 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,595,211 Number of Sequences: 28952 Number of extensions: 237307 Number of successful extensions: 612 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 600 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 612 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1438152744 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -