BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30874 (792 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 24 1.9 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 3.3 AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 22 5.7 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 22 5.7 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 23.8 bits (49), Expect = 1.9 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -3 Query: 310 NGFPSSSLYAPTPRFTFLGCVSFLYASVM 224 N P S Y FLGC FL+A+++ Sbjct: 283 NSLPKVS-YIKASEIWFLGCTIFLFAAMV 310 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.0 bits (47), Expect = 3.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +2 Query: 197 DGSARCNLRHYRSIQEG 247 DG AR N+ H++ I+ G Sbjct: 535 DGPARYNIIHFKQIEPG 551 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 22.2 bits (45), Expect = 5.7 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -2 Query: 431 SKSQFSYSISICGLTTDGSILMIESSTMENFFCLS 327 S S SY IC LT + + + T N F LS Sbjct: 513 SLSDGSYFGEICLLTNARRVASVRAETYCNLFSLS 547 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 22.2 bits (45), Expect = 5.7 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -2 Query: 431 SKSQFSYSISICGLTTDGSILMIESSTMENFFCLS 327 S S SY IC LT + + + T N F LS Sbjct: 481 SLSDGSYFGEICLLTNARRVASVRAETYCNLFSLS 515 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 241,435 Number of Sequences: 438 Number of extensions: 5863 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25003662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -