BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30873 (660 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 23 2.6 M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-... 21 7.9 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 23.0 bits (47), Expect = 2.6 Identities = 14/50 (28%), Positives = 21/50 (42%) Frame = +3 Query: 33 IKLSRVSPFAALIN*QRKLHEAFQDGVFYKERYEEMCSSGDWMQPRRPPN 182 ++L R PF+ I RK+ D YE+ S + + R PN Sbjct: 74 MQLGRRQPFSLFIPAHRKIAARLIDIFMGMRTYEDFLSVAVYCRDRLNPN 123 >M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H55. ). Length = 86 Score = 21.4 bits (43), Expect = 7.9 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +1 Query: 565 KGRTMYVIPFSMGPVGSP 618 K +M ++P+ M P G P Sbjct: 68 KMASMNIVPYHMSPYGHP 85 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,352 Number of Sequences: 438 Number of extensions: 4496 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19855845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -