BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30871 (680 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholi... 23 2.0 EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholi... 23 2.0 EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholi... 23 2.0 DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholi... 23 2.0 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 23 2.7 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 3.6 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 22 6.2 >EF127802-1|ABL67939.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 3 protein. Length = 461 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 384 TGDEVIIIEPYFDCYDFMV 440 T D V +I YF+C FMV Sbjct: 250 TSDAVPLIGSYFNCIMFMV 268 >EF127801-1|ABL67938.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 2 protein. Length = 461 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 384 TGDEVIIIEPYFDCYDFMV 440 T D V +I YF+C FMV Sbjct: 250 TSDAVPLIGSYFNCIMFMV 268 >EF127800-1|ABL67937.1| 461|Apis mellifera nicotinic acetylcholine receptor subunitalpha 6 transcript variant 1 protein. Length = 461 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 384 TGDEVIIIEPYFDCYDFMV 440 T D V +I YF+C FMV Sbjct: 250 TSDAVPLIGSYFNCIMFMV 268 >DQ026035-1|AAY87894.1| 529|Apis mellifera nicotinic acetylcholine receptor alpha6subunit protein. Length = 529 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = +3 Query: 384 TGDEVIIIEPYFDCYDFMV 440 T D V +I YF+C FMV Sbjct: 318 TSDAVPLIGSYFNCIMFMV 336 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/47 (21%), Positives = 23/47 (48%) Frame = +3 Query: 90 WVEYIQLAAEYKPAVNLGQGFPDYHAPKHVTEALSQIATSENPLLHQ 230 W E + A+ +P+ ++ Q +P+ P+ +A+ + +E Q Sbjct: 22 WEEIRRQASVEQPSFSVHQVYPENLIPRLAKKAIQVLGVTEKEFFDQ 68 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.6 bits (46), Expect = 3.6 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 384 TGDEVIIIEPYFDCYDFMV 440 T D V ++ YF+C FMV Sbjct: 287 TSDAVPLLGTYFNCIMFMV 305 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 21.8 bits (44), Expect = 6.2 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +2 Query: 149 LS*LSRTETCNRSTIADSYQ*KSTASSVHKRLWS 250 LS R E R+ +D YQ K+ V K WS Sbjct: 248 LSNKQRFEYFTRTIPSDHYQVKAMVEIVMKMKWS 281 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 196,645 Number of Sequences: 438 Number of extensions: 4323 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20708550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -