BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30867 (710 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U21319-1|AAC46673.2| 258|Caenorhabditis elegans Hypothetical pr... 31 0.61 Z93375-2|CAB07564.2| 359|Caenorhabditis elegans Hypothetical pr... 29 4.3 >U21319-1|AAC46673.2| 258|Caenorhabditis elegans Hypothetical protein C30G12.4 protein. Length = 258 Score = 31.5 bits (68), Expect = 0.61 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 24 CSLPRSYSYIATTYNLVFFVSVSDKCLSIILSC 122 CSL SYSY+ + L+ + +SI+LSC Sbjct: 101 CSLTFSYSYMMVSCKLLLYYGTFSSIISIVLSC 133 >Z93375-2|CAB07564.2| 359|Caenorhabditis elegans Hypothetical protein C38C6.4 protein. Length = 359 Score = 28.7 bits (61), Expect = 4.3 Identities = 16/47 (34%), Positives = 25/47 (53%) Frame = +3 Query: 36 RSYSYIATTYNLVFFVSVSDKCLSIILSCNYSLDLIIIIKTYKFTVS 176 ++YS I +YN FV L I+ Y L++ I IKT +F+ + Sbjct: 21 KTYSIIEGSYNYYLFVFYIQIALIFIVLFYYLLNVYIDIKTCQFSTN 67 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,855,783 Number of Sequences: 27780 Number of extensions: 265930 Number of successful extensions: 421 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 416 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 421 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1655655746 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -