BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30860 (697 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02990.1 68418.m00243 kelch repeat-containing F-box family pr... 29 3.9 At1g24340.1 68414.m03070 monooxygenase family protein similar to... 28 5.1 At5g52420.1 68418.m06505 expressed protein 27 9.0 At4g28010.1 68417.m04018 pentatricopeptide (PPR) repeat-containi... 27 9.0 >At5g02990.1 68418.m00243 kelch repeat-containing F-box family protein contains Pfam profiles PF01344: Kelch motif, PF00646: F-box domain Length = 548 Score = 28.7 bits (61), Expect = 3.9 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 370 STGMCCNGSAVKIVGDFCCGTSKLSLII 453 S+ + NGS + IVG F CGTS + + Sbjct: 311 SSTVVANGSDIYIVGGFVCGTSSKRVFV 338 >At1g24340.1 68414.m03070 monooxygenase family protein similar to polyketide hydroxylases from several bacterial species; contains Pfam:PF01360 [Monooxygenase] Length = 707 Score = 28.3 bits (60), Expect = 5.1 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +1 Query: 298 YFRIRGLSEFVIGNSVYITFFIFNSTGM 381 +F R L E++I N + FFIFN+ G+ Sbjct: 305 HFMSRELGEYLISNRPGMLFFIFNTDGI 332 >At5g52420.1 68418.m06505 expressed protein Length = 242 Score = 27.5 bits (58), Expect = 9.0 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -1 Query: 586 YFFFFRKYIF*LHNTPN 536 YFFF K IF HN PN Sbjct: 74 YFFFLSKLIFPPHNNPN 90 >At4g28010.1 68417.m04018 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 704 Score = 27.5 bits (58), Expect = 9.0 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -3 Query: 164 NKNLTLFLLVKNTECCEKITFLREKEREF*IPYQIFIYEFFLK 36 N N+ L L +N EC + ++ LRE R +P +F Y ++ Sbjct: 144 NHNILLKGLCRNLECGKAVSLLREMRRNSLMP-DVFSYNTVIR 185 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,710,957 Number of Sequences: 28952 Number of extensions: 200338 Number of successful extensions: 398 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 392 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 398 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1487069504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -