BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30855 (667 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 29 0.026 EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-toler... 23 2.2 DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory pro... 22 5.2 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 5.2 EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B pro... 21 6.9 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 21 9.1 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 9.1 AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix... 21 9.1 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 29.5 bits (63), Expect = 0.026 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +2 Query: 8 PNSARGGHISFLTVVKFKTQQWVTSKTHTSRPETPGPQPPS 130 P S+ GG IS + +T W++S + P TP P PPS Sbjct: 87 PFSSIGGGIS--ASKRQRTDDWLSSPSGNVPPLTPSPGPPS 125 >EF468474-1|ABR25244.1| 516|Tribolium castaneum methoprene-tolerant protein. Length = 516 Score = 23.0 bits (47), Expect = 2.2 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = +1 Query: 160 GFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFN 270 GF+++ KIV +S + GH + L+G IFN Sbjct: 114 GFLLILTPNGKIVFVSHTVEHLLGHLQTDLMGQSIFN 150 >DQ855488-1|ABH88175.1| 112|Tribolium castaneum chemosensory protein 1 protein. Length = 112 Score = 21.8 bits (44), Expect = 5.2 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -3 Query: 119 EAPESPVSKCVSSMSPIVV 63 EAP PV + + S++P+V+ Sbjct: 55 EAPCDPVGRRLKSLAPLVL 73 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 5.2 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +2 Query: 101 PETPGPQPPSPCNVRPCVKTVSLC*RVVH 187 P+ GPQP S C+ C R +H Sbjct: 1268 PKMGGPQPYSACSENAFAAYPGDCTRYLH 1296 >EF125544-1|ABL73928.1| 279|Tribolium castaneum obstractor B protein. Length = 279 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +2 Query: 92 TSRPETPGPQPPSPC 136 TSRP+ PQP C Sbjct: 93 TSRPKLQEPQPSQHC 107 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 21.0 bits (42), Expect = 9.1 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 80 SKTHTSRPETPGPQPPS 130 S +HT TP +PPS Sbjct: 60 STSHTDGASTPDVRPPS 76 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 21.0 bits (42), Expect = 9.1 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 80 SKTHTSRPETPGPQPPS 130 S +HT TP +PPS Sbjct: 216 STSHTDGASTPDVRPPS 232 >AJ457831-1|CAD29886.1| 249|Tribolium castaneum helix-loop-helix transcription factor protein. Length = 249 Score = 21.0 bits (42), Expect = 9.1 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +2 Query: 77 TSKTHTSRPETPGPQPPSPCNVRPCVKTVSLC 172 T+ T +S Q P P +VRP V C Sbjct: 206 TASTASSASNYSPSQSPEPESVRPLSLVVRRC 237 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 162,780 Number of Sequences: 336 Number of extensions: 3709 Number of successful extensions: 11 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 17281430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -