BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30853 (704 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 24 1.4 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 24 1.4 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 2.4 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 21 7.4 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 23.8 bits (49), Expect = 1.4 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +2 Query: 515 HIATSHQPTYLNKTFKLF*-NSF*NWNDLSTSIXMIGIVTIKNIICYLILC 664 +I+TS+ + T L+ +S N+N+ S+S+ I T + C +I+C Sbjct: 30 NISTSNYLYTPSSTIDLYNTSSVSNFNESSSSVFPNYIRTTSMVFCIIIMC 80 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 23.8 bits (49), Expect = 1.4 Identities = 15/51 (29%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = +2 Query: 515 HIATSHQPTYLNKTFKLF*-NSF*NWNDLSTSIXMIGIVTIKNIICYLILC 664 +I+TS+ + T L+ +S N+N+ S+S+ I T + C +I+C Sbjct: 30 NISTSNYLYTPSSTIDLYNTSSVSNFNESSSSVFPNYIRTTSMVFCIIIMC 80 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.0 bits (47), Expect = 2.4 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -2 Query: 673 CIFTQN*IAYNIFYCYYSN 617 C+ N I ++ YCYY++ Sbjct: 261 CLIQFNTIVFSFCYCYYNS 279 Score = 22.6 bits (46), Expect = 3.2 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -2 Query: 673 CIFTQN*IAYNIFYCYYS 620 C+ N I + YCYYS Sbjct: 542 CLIQFNTIVFAFCYCYYS 559 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = +3 Query: 36 IFELSLCWRIYHLMRKIRLI 95 +F + LC R+ KIRLI Sbjct: 241 LFVIYLCGRVMEEQNKIRLI 260 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,685 Number of Sequences: 336 Number of extensions: 3521 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -