BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30850 (619 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g08760.1 68414.m00975 expressed protein similar to At1g21030,... 27 10.0 >At1g08760.1 68414.m00975 expressed protein similar to At1g21030, At5g44890, At2g29240, At1g08740; similar to EST gb|N96641 Length = 748 Score = 27.1 bits (57), Expect = 10.0 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +1 Query: 418 LTNASSLITSVALAPVEDSIGSFTTTAGAATIVLEPTDTSSLITS 552 L A S +S++L ++S+G T++G+ +I PT SL S Sbjct: 188 LFRAKSAKSSLSLDVKKESLGKLKTSSGSKSIPSSPTSCYSLPNS 232 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,072,167 Number of Sequences: 28952 Number of extensions: 169791 Number of successful extensions: 418 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 402 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 418 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1246162608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -