BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30849 (709 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 30 0.082 AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. 23 9.4 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 29.9 bits (64), Expect = 0.082 Identities = 11/33 (33%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = -2 Query: 510 HLHTHYYIQFHSQVHFPSCKSLY-GSISLHTYC 415 H+ HY++ F + P C++ Y S +L T+C Sbjct: 511 HIRNHYHVHFPGRFECPLCRATYTRSDNLRTHC 543 >AJ535206-1|CAD59406.1| 1376|Anopheles gambiae SMC4 protein protein. Length = 1376 Score = 23.0 bits (47), Expect = 9.4 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = -1 Query: 568 SKSDLQSDCASLEYLVAGVSST 503 SK+ ++DC LEYL V +T Sbjct: 228 SKAQTENDCGLLEYLEDIVGTT 249 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 713,953 Number of Sequences: 2352 Number of extensions: 14975 Number of successful extensions: 27 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 27 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 27 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 72340815 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -