BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30848 (751 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC297.03 |ssp1||serine/threonine protein kinase Ssp1 |Schizosa... 27 3.8 SPAC1F3.06c |spo15||sporulation protein Spo15|Schizosaccharomyce... 25 8.7 >SPCC297.03 |ssp1||serine/threonine protein kinase Ssp1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 652 Score = 26.6 bits (56), Expect = 3.8 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = +1 Query: 247 IYSNDTQ*FLIKWKLYHVWGHVKT*QKVKK 336 +YS++ Q +WK WG VK +K++K Sbjct: 92 LYSDNFQEAQRQWKRLQEWGEVKETKKIRK 121 >SPAC1F3.06c |spo15||sporulation protein Spo15|Schizosaccharomyces pombe|chr 1|||Manual Length = 1957 Score = 25.4 bits (53), Expect = 8.7 Identities = 20/52 (38%), Positives = 28/52 (53%), Gaps = 6/52 (11%) Frame = -1 Query: 577 RSEASLSYSLYHQLPIRESPVKIGP------AIPEVSRNKQTNRQKKIVNVI 440 R +LS S YH L +R+SP K P +IP V+ KQ+ + I+ VI Sbjct: 1883 RKSLALSKSAYHNLLVRDSP-KFNPDSQITYSIP-VTNTKQSLLRSAILCVI 1932 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,786,886 Number of Sequences: 5004 Number of extensions: 57371 Number of successful extensions: 126 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 126 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -