BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30845 (733 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0270 - 2225250-2225263,2225549-2225732,2225817-2225972,222... 36 0.025 12_02_0538 + 20134594-20136042 29 5.0 >01_01_0270 - 2225250-2225263,2225549-2225732,2225817-2225972, 2226276-2226374,2226489-2226563,2226682-2226750, 2226917-2227115,2227492-2227597,2228118-2228526 Length = 436 Score = 36.3 bits (80), Expect = 0.025 Identities = 17/44 (38%), Positives = 24/44 (54%) Frame = +2 Query: 221 LPPASRIHFDNIMFNPYSGVVKYELYTIRKYLREFTERIILSSP 352 LPP S+I FD ++ V K +L K+ +EF+E I SP Sbjct: 374 LPPISKIDFDEVLVRQRPTVSKKDLVVYEKFTQEFSEEEIFISP 417 >12_02_0538 + 20134594-20136042 Length = 482 Score = 28.7 bits (61), Expect = 5.0 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 252 ILCLTLILGLSNTNCILYGNTCENLQ 329 ILCL +LGL++++ I C NL+ Sbjct: 267 ILCLHFVLGLTDSDMITLSQNCSNLK 292 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,565,163 Number of Sequences: 37544 Number of extensions: 285073 Number of successful extensions: 595 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 582 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 595 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1921741964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -