BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30845 (733 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 26 0.42 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 5.2 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 5.2 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 6.8 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 6.8 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 25.8 bits (54), Expect = 0.42 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -2 Query: 510 KGSRNKATLFLNKSNLLERIEKTMPLIVIIG 418 K KATLFLN +++ RI + ++++IG Sbjct: 260 KSPVRKATLFLNMASVFMRIFNLICMMLLIG 290 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 5.2 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +2 Query: 200 VRGSQYALPPASRIHFDN 253 +RG + + P SR+ F N Sbjct: 27 LRGPSFVMEPPSRVEFSN 44 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 5.2 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +2 Query: 200 VRGSQYALPPASRIHFDN 253 +RG + + P SR+ F N Sbjct: 27 LRGPSFVMEPPSRVEFSN 44 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 21.8 bits (44), Expect = 6.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 639 CLIVTCVWLCVSVFVFDI 586 C +T +CV VF F+I Sbjct: 494 CWTITTPAICVGVFTFNI 511 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 6.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 639 CLIVTCVWLCVSVFVFDI 586 C +T +CV VF F+I Sbjct: 547 CWTITTPAICVGVFTFNI 564 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,825 Number of Sequences: 438 Number of extensions: 3637 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -