BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30845 (733 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g30470.1 68414.m03724 SIT4 phosphatase-associated family prot... 32 0.45 At4g38020.1 68417.m05371 tRNA/rRNA methyltransferase (SpoU) fami... 30 1.4 At1g36000.1 68414.m04471 LOB domain family protein / lateral org... 30 1.8 At5g11070.1 68418.m01293 expressed protein 29 3.2 At2g19510.1 68415.m02280 LOB domain family protein / lateral org... 27 9.7 >At1g30470.1 68414.m03724 SIT4 phosphatase-associated family protein contains similarity to copper chaperone homolog CCH GB:AAF15286 GI:6525011 from [Glycine max]; contains Pfam profile PF04499: SIT4 phosphatase-associated protein Length = 811 Score = 31.9 bits (69), Expect = 0.45 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = +2 Query: 524 KKQLRI*NLNVQCQMSNSLVRMSNTNTDTHNHTQVTIK 637 KK LRI N+ ++SN L++++N+N + +H Q K Sbjct: 436 KKPLRIGNIGHLTRISNKLLQLANSNVEIQSHLQENSK 473 >At4g38020.1 68417.m05371 tRNA/rRNA methyltransferase (SpoU) family protein similar to SP|P18644 rRNA (adenosine-2'-O-)-methyltransferase (EC 2.1.1.66) {Streptomyces cyaneus}; contains Pfam profile PF00588: SpoU rRNA Methylase (RNA methyltransferase, TrmH) family Length = 352 Score = 30.3 bits (65), Expect = 1.4 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = +3 Query: 126 MRHCIAL*AASFFKHNYGLAIEIGKFEAHNTLYHQ--HQGFTSIILCLTL 269 ++HC+ L +S ++H +G + +G Q QG T+ I CL L Sbjct: 77 VKHCLKLRQSSSYRHAHGSVLVVGTIPIREVCMFQTNKQGMTTEIECLLL 126 >At1g36000.1 68414.m04471 LOB domain family protein / lateral organ boundaries domain family protein (LBD5) identical to SP|Q9C8V8 Putative LOB domain protein 5 {Arabidopsis thaliana}; similar to lateral organ boundaries (LOB) domain-containing proteins from Arabidopsis thaliana Length = 122 Score = 29.9 bits (64), Expect = 1.8 Identities = 9/30 (30%), Positives = 20/30 (66%) Frame = -1 Query: 367 AVCMLRTRQDYSFCKFSQVFPYSIQFVFDN 278 +VC+ + R FC++++ FPY +Q +++ Sbjct: 11 SVCITKNRNCPRFCEYAEYFPYELQSQYES 40 >At5g11070.1 68418.m01293 expressed protein Length = 152 Score = 29.1 bits (62), Expect = 3.2 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 11/55 (20%) Frame = +1 Query: 499 PRSFCQLMQKTTQDMKFK----RPMSNVKFTC-------TNVKHEHRHTQPHTGD 630 PRS + ++ T Q+++ + R S +K TC N H H H+Q + GD Sbjct: 49 PRSPYEWLKSTAQELELRDRCRRVKSRIKVTCRNNNCAYNNCVHHHHHSQSYPGD 103 >At2g19510.1 68415.m02280 LOB domain family protein / lateral organ boundaries domain family protein (LBD8) identical to SP|Q9ZUP0| Putative LOB domain protein 8 {Arabidopsis thaliana}; similar to lateral organ boundaries (LOB) domain-containing proteins from Arabidopsis thaliana; identical to ASYMMETRIC LEAVES2-like protein 34 [Arabidopsis thaliana] GI:19919039 Length = 120 Score = 27.5 bits (58), Expect = 9.7 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = -1 Query: 364 VCMLRTRQDYSFCKFSQVFPYSIQFVFDN 278 VC+ + R FC++++ FPY ++ +++ Sbjct: 12 VCITKNRNCPRFCEYAEYFPYELRSHYES 40 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,322,415 Number of Sequences: 28952 Number of extensions: 256154 Number of successful extensions: 548 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 535 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 548 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1604469728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -