BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30838 (549 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 23 5.0 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 5.0 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 5.0 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 5.0 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 23.4 bits (48), Expect = 5.0 Identities = 11/33 (33%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +2 Query: 29 IGKARINMENILI-WKKKLWISQYIYFFLSQRG 124 +G N+E+ I WK+K W + YF + G Sbjct: 208 LGDDDANIEDYFITWKEKFWPTVCDYFGIESTG 240 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.4 bits (48), Expect = 5.0 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 200 VMCHAVTLNDTSILVH 153 V+CHA+ N +LVH Sbjct: 404 VVCHAIERNGRPVLVH 419 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.4 bits (48), Expect = 5.0 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 200 VMCHAVTLNDTSILVH 153 V+CHA+ N +LVH Sbjct: 404 VVCHAIERNGRPVLVH 419 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.4 bits (48), Expect = 5.0 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = +3 Query: 291 HNHCYRGFFCCLDGWTSP 344 H C G C +GWT P Sbjct: 608 HGRCVCGQCECREGWTGP 625 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 575,308 Number of Sequences: 2352 Number of extensions: 11549 Number of successful extensions: 39 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50881347 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -