BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30838 (549 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein p... 23 1.5 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 23 2.7 AB252421-1|BAE80739.1| 122|Apis mellifera GB15078 protein. 23 2.7 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 22 3.6 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 6.2 >DQ257415-1|ABB81846.1| 430|Apis mellifera yellow-like protein protein. Length = 430 Score = 23.4 bits (48), Expect = 1.5 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = -1 Query: 366 PLNTRWTVGSSTRLSNKKNLCSNGYELILII 274 PL++R STR+ +NL N Y I+ Sbjct: 278 PLSSRREFAVSTRILRDENLSQNSYHEFQIL 308 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 22.6 bits (46), Expect = 2.7 Identities = 9/25 (36%), Positives = 11/25 (44%) Frame = +3 Query: 432 GLSTSHPSWLSLCSPTCPGETGKAF 506 G SH +W+ S T PG F Sbjct: 540 GSGLSHGNWIYPASMTIPGSNSAVF 564 >AB252421-1|BAE80739.1| 122|Apis mellifera GB15078 protein. Length = 122 Score = 22.6 bits (46), Expect = 2.7 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = +3 Query: 312 FFCCLDGWTSPQSTW 356 FFC G+ P+ TW Sbjct: 42 FFCMATGFPRPEITW 56 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 22.2 bits (45), Expect = 3.6 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = +2 Query: 140 YLYFREQVSKCHLM 181 Y+Y REQ S+ HL+ Sbjct: 338 YMYSREQYSQSHLI 351 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.4 bits (43), Expect = 6.2 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 318 CCLDGWTSPQSTW 356 C DG+ PQ TW Sbjct: 700 CKADGFPKPQVTW 712 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,852 Number of Sequences: 438 Number of extensions: 3577 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -