BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= maV30832
(619 letters)
Database: bee
438 sequences; 146,343 total letters
Searching......................................................done
Score E
Sequences producing significant alignments: (bits) Value
DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450 monoo... 21 9.6
AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 21 9.6
>DQ244075-1|ABB36785.1| 548|Apis mellifera cytochrome P450
monooxygenase protein.
Length = 548
Score = 21.0 bits (42), Expect = 9.6
Identities = 8/12 (66%), Positives = 10/12 (83%)
Frame = -2
Query: 561 GENQIVLLHLIH 526
G+NQI LL +IH
Sbjct: 241 GKNQIKLLEIIH 252
>AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation
factor 2 protein.
Length = 690
Score = 21.0 bits (42), Expect = 9.6
Identities = 9/33 (27%), Positives = 16/33 (48%)
Frame = +3
Query: 120 EHKIRNLEKRKSKLTSYRDLQKAGKELNSDQKV 218
EHK +K + L Y+ + K + D+K+
Sbjct: 423 EHKAAADQKLEKHLIEYKKMLKIKRLFGKDRKI 455
Database: bee
Posted date: Oct 23, 2007 1:17 PM
Number of letters in database: 146,343
Number of sequences in database: 438
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 152,926
Number of Sequences: 438
Number of extensions: 2822
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 146,343
effective HSP length: 55
effective length of database: 122,253
effective search space used: 18337950
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -