BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30830 (309 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-2641|AAN10914.1| 1931|Drosophila melanogaster CG18109-P... 29 1.2 >AE014134-2641|AAN10914.1| 1931|Drosophila melanogaster CG18109-PA protein. Length = 1931 Score = 29.1 bits (62), Expect = 1.2 Identities = 12/43 (27%), Positives = 25/43 (58%) Frame = +1 Query: 160 DPKLSDLYLSRSAEFESSGKYIALTAQTLISKTK*MVFILKVF 288 DP+LS++ +S E S KY+A+ ++ + + + +L+ F Sbjct: 1516 DPQLSEILISVGKTMEYSEKYLAINFESCVPRKEVRCMLLETF 1558 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,499,578 Number of Sequences: 53049 Number of extensions: 76059 Number of successful extensions: 178 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 177 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 178 length of database: 24,988,368 effective HSP length: 74 effective length of database: 21,062,742 effective search space used: 589756776 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -