BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30828 (674 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 pr... 25 2.9 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 8.8 >AY028785-1|AAK32959.1| 509|Anopheles gambiae cytochrome P450 protein. Length = 509 Score = 24.6 bits (51), Expect = 2.9 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = -1 Query: 503 QPRAHHNLQQSFAIFVRILMLDCDSNLLKEIINLLFLKFHD 381 Q R + SF F+ I+M+ CD L+K ++ F FHD Sbjct: 68 QDRGERYMGYSF-FFMPIVMV-CDIELVKTVLVKDFAVFHD 106 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 592 RITSPIRYFWATTGDGK 542 +I +P YFW DGK Sbjct: 238 QIYNPTNYFWEPNPDGK 254 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 761,908 Number of Sequences: 2352 Number of extensions: 16138 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -