BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30825 (703 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 24 1.6 AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II ... 23 3.7 AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier... 21 8.6 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 23.8 bits (49), Expect = 1.6 Identities = 15/54 (27%), Positives = 30/54 (55%) Frame = +2 Query: 164 SVIRTIMTSTLSVRDRASPSDVV*VDIKKLIHSQNKIQCVTGSPIDNIRSVNRS 325 +V+R +S+ S ++ + VDI KL++ +N + T S N+ +VN++ Sbjct: 493 AVVRQSEEEAVSLLINFSKNNTI-VDISKLVNKRNNAKIYTSSVNSNL-TVNQT 544 >AB013287-1|BAA87893.1| 190|Apis mellifera calmodulin kinase II protein. Length = 190 Score = 22.6 bits (46), Expect = 3.7 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 497 FGFSGSRAATNPRLRRNEPDGE 562 FGF+G+ +P + + EP G+ Sbjct: 70 FGFAGTPGYLSPEVLKKEPYGK 91 >AY736135-1|AAU84701.1| 253|Apis mellifera take-out-like carrier protein JHBP-1 protein. Length = 253 Score = 21.4 bits (43), Expect = 8.6 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +3 Query: 516 VLLPTRGSGATNPTENRQVHDRRAH 590 +LLP RG+G +N T ++D ++H Sbjct: 138 LLLPVRGAGKSNIT----MYDLKSH 158 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,758 Number of Sequences: 438 Number of extensions: 3674 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -