BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30823 (716 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19C2.02 |pmt1||DNA methyltransferase homolog|Schizosaccharom... 27 2.0 SPBC26H8.10 |dis3|rrp44|3'-5' exoribonuclease subunit Dis3 |Schi... 25 8.2 >SPBC19C2.02 |pmt1||DNA methyltransferase homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 330 Score = 27.5 bits (58), Expect = 2.0 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 454 CRLRTTLVHLFPYIKKGKRPDSLDKEQKCFQTLVFVGPH 570 C+L T P+ + G R D LD + F ++ V PH Sbjct: 72 CKLWTMSPSCQPFTRIGNRKDILDPRSQAFLNILNVLPH 110 >SPBC26H8.10 |dis3|rrp44|3'-5' exoribonuclease subunit Dis3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 970 Score = 25.4 bits (53), Expect = 8.2 Identities = 12/30 (40%), Positives = 18/30 (60%) Frame = +2 Query: 518 HWTKNRSVFRH*SLLVHTGKLNRSTYSYRE 607 HW+ +R + + VH G +N STY+Y E Sbjct: 251 HWSMSRLLACIKNGEVHKGLINISTYNYLE 280 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,035,255 Number of Sequences: 5004 Number of extensions: 64302 Number of successful extensions: 113 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 108 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 335201398 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -