BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30823 (716 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_02_0132 + 8655333-8655461,8655864-8656016 30 2.1 04_03_0512 + 16675940-16677193,16677325-16677853,16678920-166789... 28 6.4 >11_02_0132 + 8655333-8655461,8655864-8656016 Length = 93 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -2 Query: 424 ICCNHWTTGHLSRVRHYLVPRSSPTKNLPIKFHIP 320 +C + T GHLS +R VPR+ NLP ++P Sbjct: 1 MCGHDPTNGHLSSLRKNEVPRTQSIDNLPKTANLP 35 >04_03_0512 + 16675940-16677193,16677325-16677853,16678920-16678999, 16679450-16679533 Length = 648 Score = 28.3 bits (60), Expect = 6.4 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -2 Query: 421 CCNHWTTGHLSRVRHYLVPRSSPTKNL 341 C N WT GH + +R ++P S+PT +L Sbjct: 9 CSNGWTDGH-APMRLLMLPPSTPTTSL 34 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,778,861 Number of Sequences: 37544 Number of extensions: 381838 Number of successful extensions: 674 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 674 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1862792824 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -