BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30823 (716 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49546| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_19395| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 >SB_49546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1214 Score = 29.5 bits (63), Expect = 2.8 Identities = 24/85 (28%), Positives = 37/85 (43%), Gaps = 1/85 (1%) Frame = +2 Query: 386 SAQVAGCPMVTADDKIIWNSLCAVDLGQH*SIFSRI*RRVKDPTHWTKNRSVFRH*SLLV 565 SA + C M+ K N+ C +LG++ + R +K +W RS S +V Sbjct: 516 SAHLKFCKMLLGTGKTAVNNACRGELGRYPLCINATYRNIK---YWINLRSKEEALSKVV 572 Query: 566 HTGKLNRSTYSY-REPTRHSGFKGG 637 +T +N SY T+ FK G Sbjct: 573 YTECVNNPHVSYWTHKTKEIIFKAG 597 >SB_19395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 832 Score = 28.3 bits (60), Expect = 6.6 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +1 Query: 16 CLNNKRKKVTRDLSKG 63 CLN KRK++TRD+ G Sbjct: 603 CLNGKRKRLTRDVDSG 618 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,085,751 Number of Sequences: 59808 Number of extensions: 458261 Number of successful extensions: 704 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 678 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 704 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1901817086 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -