BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30821 (340 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0665 - 18506221-18506271,18506331-18506401,18507097-185071... 31 0.17 11_04_0460 - 17955102-17955146,17955253-17955310,17955442-179555... 29 0.70 03_06_0034 + 31197846-31198417,31198562-31198987,31199074-311993... 29 0.93 02_01_0129 - 934865-935152,935241-935490,935965-936105,937175-93... 29 1.2 12_02_1275 - 27482784-27483272 28 1.6 06_03_0685 - 23499779-23500204 28 1.6 04_03_0489 + 16503325-16503747,16503916-16503978 28 2.1 09_06_0293 + 22086359-22086496,22086604-22087213,22087407-220879... 27 2.8 03_05_0057 + 20350971-20351405 27 2.8 01_06_0997 + 33676441-33676758,33678223-33678314,33678443-336785... 27 2.8 01_01_1225 - 9894899-9895333 27 2.8 09_04_0361 - 16948740-16948860,16948951-16949018,16949424-169495... 27 3.8 09_02_0425 + 9167684-9167803,9168034-9168108,9168200-9168653,916... 27 3.8 05_03_0408 + 13601576-13601748,13601795-13602104,13602597-136028... 27 3.8 05_04_0347 + 20479682-20479753,20480136-20480813,20481143-204821... 27 5.0 04_03_0890 + 20576843-20578119,20578563-20578806,20578890-20580002 27 5.0 04_01_0314 - 4243928-4244361,4245178-4245415 27 5.0 03_04_0163 + 17865529-17865801,17866030-17866102,17866251-17866270 27 5.0 08_02_1499 - 27558872-27559015,27559544-27559666,27560214-275603... 26 6.6 06_03_0786 - 24579722-24580137,24580518-24580590 26 6.6 04_03_0771 + 19434460-19434987 26 6.6 01_06_0691 - 31268729-31269010,31269596-31270051,31270560-31271735 26 6.6 08_02_1345 - 26286448-26286679,26287483-26288038,26288068-262883... 26 8.7 08_02_0833 - 21623721-21623821,21624076-21624667 26 8.7 08_01_0133 + 1062365-1063057,1063210-1063318,1063914-1064005,106... 26 8.7 07_01_0538 + 3982952-3983297,3983397-3983489,3983627-3983733 26 8.7 05_03_0446 + 14111667-14111906,14112011-14112418 26 8.7 04_04_0407 - 24983491-24983575,24983655-24984015,24984367-249844... 26 8.7 >04_03_0665 - 18506221-18506271,18506331-18506401,18507097-18507169, 18507476-18507805 Length = 174 Score = 31.5 bits (68), Expect = 0.17 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 149 WKWCGLRRDQTGREG 193 W WCGLRR + GR G Sbjct: 65 WMWCGLRRSKAGRRG 79 >11_04_0460 - 17955102-17955146,17955253-17955310,17955442-17955593, 17955888-17955993,17956101-17956222,17956766-17956834, 17956969-17957214,17957331-17957373,17957449-17957520, 17957954-17958066,17958158-17958238,17958343-17958415, 17959413-17959519,17960410-17960514,17960684-17960974, 17961621-17961707,17961774-17961842,17961917-17961973, 17962057-17962155,17962223-17962312,17962395-17962511, 17964164-17964244,17964353-17964502,17964812-17964956, 17967359-17967510,17967647-17967784,17967838-17967914, 17968032-17968134 Length = 1015 Score = 29.5 bits (63), Expect = 0.70 Identities = 18/55 (32%), Positives = 27/55 (49%) Frame = +3 Query: 123 SSSISKYYNGNGVDSVETKQVEKVYSGDGASLSAPGSKRSALSASDAECFSLCLG 287 SSS S+Y N +G +T +++ SG +S S +S+ D E L LG Sbjct: 781 SSSSSRYSNSSGTIFQKTSVQKRLSSGSSSSSKNKRSTAVVMSSPDCELDLLLLG 835 >03_06_0034 + 31197846-31198417,31198562-31198987,31199074-31199386, 31199510-31199560 Length = 453 Score = 29.1 bits (62), Expect = 0.93 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -1 Query: 244 AERLLPGALRDAPSPE*TFSTCLVSTESTPF 152 ++RL+ ALR PSP F++ L +TPF Sbjct: 39 SQRLVYAALRSLPSPRALFASLLSQLSATPF 69 >02_01_0129 - 934865-935152,935241-935490,935965-936105,937175-937707 Length = 403 Score = 28.7 bits (61), Expect = 1.2 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 1/29 (3%) Frame = +1 Query: 235 NAQLC-RLRTPSVSRCAWAPGLCGGPDVP 318 NA C R P V+ +WAP CGG VP Sbjct: 75 NAWNCPRNSRPPVAALSWAPARCGGGAVP 103 >12_02_1275 - 27482784-27483272 Length = 162 Score = 28.3 bits (60), Expect = 1.6 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 146 QWKWCGLRRDQTGREG 193 +W W GLRR +TGR G Sbjct: 144 RWVWRGLRRTKTGRRG 159 >06_03_0685 - 23499779-23500204 Length = 141 Score = 28.3 bits (60), Expect = 1.6 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = +1 Query: 166 PSRPNRSRRFIPVTGRL*ALPAANAQLCRLRTPSVSRCAWAP 291 P R R RR+ P GR+ LP ++CR R P R P Sbjct: 42 PPRGGRIRRWPPRRGRIRGLPPLGGRICR-RPPRGGRIHGLP 82 >04_03_0489 + 16503325-16503747,16503916-16503978 Length = 161 Score = 27.9 bits (59), Expect = 2.1 Identities = 16/36 (44%), Positives = 18/36 (50%) Frame = +1 Query: 226 PAANAQLCRLRTPSVSRCAWAPGLCGGPDVPAHGSA 333 PAA A L RLRTP+ + C G P V H A Sbjct: 49 PAAAACLRRLRTPATAACLRRAGNPRPPPVSPHKGA 84 >09_06_0293 + 22086359-22086496,22086604-22087213,22087407-22087938, 22088617-22089151 Length = 604 Score = 27.5 bits (58), Expect = 2.8 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 146 QWKWCGLRRDQTGREG 193 +W W GLRR +TGR G Sbjct: 558 RWVWRGLRRIKTGRRG 573 >03_05_0057 + 20350971-20351405 Length = 144 Score = 27.5 bits (58), Expect = 2.8 Identities = 13/27 (48%), Positives = 15/27 (55%) Frame = +3 Query: 216 LSAPGSKRSALSASDAECFSLCLGAGP 296 LS+P + R AL D EC S AGP Sbjct: 74 LSSPKAAREALKVHDPECCSRSPSAGP 100 >01_06_0997 + 33676441-33676758,33678223-33678314,33678443-33678540, 33678824-33678979,33679106-33679731,33679826-33679896, 33679987-33680241,33680337-33680454,33680595-33680766, 33680854-33681395 Length = 815 Score = 27.5 bits (58), Expect = 2.8 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +2 Query: 146 QWKWCGLRRDQTGREG 193 +W+W GLRR + GR G Sbjct: 64 RWEWHGLRRTKAGRRG 79 >01_01_1225 - 9894899-9895333 Length = 144 Score = 27.5 bits (58), Expect = 2.8 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -1 Query: 334 VQSREQGHQDHHRGPAPRHSEKHSASEADRAERLLPGA 221 V + + H+ H R P+P + K S ++A A R LP A Sbjct: 55 VVAAHRRHRRHRRSPSPPDA-KRSTADATVAPRFLPAA 91 >09_04_0361 - 16948740-16948860,16948951-16949018,16949424-16949510, 16949626-16949694,16949786-16949854,16949944-16950765 Length = 411 Score = 27.1 bits (57), Expect = 3.8 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -1 Query: 328 SREQGHQDHHRGPAPRHSEKHSASEADRAERL 233 S +GH +HHR + A E DR + L Sbjct: 50 SSSRGHAEHHRNGGGGGEHRREAGEGDRPKAL 81 >09_02_0425 + 9167684-9167803,9168034-9168108,9168200-9168653, 9168735-9168784 Length = 232 Score = 27.1 bits (57), Expect = 3.8 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +1 Query: 226 PAANAQLCRLRTPSVSRCAWAPGLCGGPDVPAHGSA 333 P Q R P++ RC+W P L PA S+ Sbjct: 82 PTRRGQQQRRHAPALRRCSWEPLLALAAAAPARDSS 117 >05_03_0408 + 13601576-13601748,13601795-13602104,13602597-13602834, 13603014-13603364,13603457-13603542,13603685-13603759, 13604241-13604542,13605359-13605622,13606032-13606806 Length = 857 Score = 27.1 bits (57), Expect = 3.8 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +1 Query: 160 WTPSRPNRSRRFIPVTG 210 + P+RP R RRF+P+ G Sbjct: 716 YPPNRPTRCRRFVPLPG 732 >05_04_0347 + 20479682-20479753,20480136-20480813,20481143-20482195, 20482345-20482406,20482491-20482541,20482635-20482719, 20483253-20483342,20483472-20483563,20483704-20483728 Length = 735 Score = 26.6 bits (56), Expect = 5.0 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +3 Query: 105 IQQLNCSSSISKYYNGNGVDSVETKQVEKVYSGDGASLSAPGS 233 +QQ N + ++ Y+G+G DS +T E V + D AS S G+ Sbjct: 89 LQQQNQQTELNLDYSGDGSDSSQTG--EDVPTADQASPSGSGT 129 >04_03_0890 + 20576843-20578119,20578563-20578806,20578890-20580002 Length = 877 Score = 26.6 bits (56), Expect = 5.0 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -1 Query: 310 QDHHRGPAPRHSEKHSASEA 251 +DHHR PR + SASEA Sbjct: 714 EDHHRSKRPRTTTTSSASEA 733 >04_01_0314 - 4243928-4244361,4245178-4245415 Length = 223 Score = 26.6 bits (56), Expect = 5.0 Identities = 20/74 (27%), Positives = 30/74 (40%) Frame = +3 Query: 84 LSKMTMLIQQLNCSSSISKYYNGNGVDSVETKQVEKVYSGDGASLSAPGSKRSALSASDA 263 L K L + N S+ ++ +N +E ++ Y GDG + P S RSA + S Sbjct: 156 LRKARALWRMSNASAGVTSKHN-----HMEEQERVAPYGGDGFQVRTPRSTRSAFT-SQL 209 Query: 264 ECFSLCLGAGPLWW 305 G WW Sbjct: 210 LASPTAARLGRRWW 223 >03_04_0163 + 17865529-17865801,17866030-17866102,17866251-17866270 Length = 121 Score = 26.6 bits (56), Expect = 5.0 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = +2 Query: 146 QWKWCGLRRDQTGREG 193 +W W GLRR + GR G Sbjct: 49 RWMWRGLRRTKAGRRG 64 >08_02_1499 - 27558872-27559015,27559544-27559666,27560214-27560312, 27561257-27561307 Length = 138 Score = 26.2 bits (55), Expect = 6.6 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -2 Query: 330 RAVSRDIRTTTEARRPGTARNTRRPKPTELSVCCRERSET 211 +AV + + T AR+ G A +P P +VCC + ET Sbjct: 17 KAVKTNSISFTSARK-GNAFLRLQPVPMRFAVCCAAKKET 55 >06_03_0786 - 24579722-24580137,24580518-24580590 Length = 162 Score = 26.2 bits (55), Expect = 6.6 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +2 Query: 146 QWKWCGLRRDQTGREGL 196 +W W GLRR + GR G+ Sbjct: 144 RWMWRGLRRMKDGRRGM 160 >04_03_0771 + 19434460-19434987 Length = 175 Score = 26.2 bits (55), Expect = 6.6 Identities = 17/56 (30%), Positives = 24/56 (42%) Frame = -1 Query: 337 AVQSREQGHQDHHRGPAPRHSEKHSASEADRAERLLPGALRDAPSPE*TFSTCLVS 170 A +RE+ HHRG A + +H+ + R LP P P ST V+ Sbjct: 76 ADSTREEAEHGHHRGRAGGEARRHTVV---LSRRSLPPESSPPPPPSPEPSTAAVA 128 >01_06_0691 - 31268729-31269010,31269596-31270051,31270560-31271735 Length = 637 Score = 26.2 bits (55), Expect = 6.6 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = -2 Query: 294 ARRPGTARNTRRPKPTELSVCCRERSETPRHRNKPSRPVWSRRSPHH 154 AR P R+ P+ + + +R TP R KPS P RSP H Sbjct: 242 ARSPPLRRDV--PELFKEAKSSSKRFSTPPPRRKPSSPPAPSRSPPH 286 >08_02_1345 - 26286448-26286679,26287483-26288038,26288068-26288358, 26288953-26290516 Length = 880 Score = 25.8 bits (54), Expect = 8.7 Identities = 18/72 (25%), Positives = 32/72 (44%) Frame = +3 Query: 111 QLNCSSSISKYYNGNGVDSVETKQVEKVYSGDGASLSAPGSKRSALSASDAECFSLCLGA 290 QL + + K +GN + V ++ +S + + + R LS+ D EC L A Sbjct: 579 QLESCNDVGK--DGNAILEVSSEHKIDTFSAEVTTEDKGKTCRYRLSSIDYECLELHFKA 636 Query: 291 GPLWWS*CPCSR 326 + W+ CS+ Sbjct: 637 EMIEWTCENCSK 648 >08_02_0833 - 21623721-21623821,21624076-21624667 Length = 230 Score = 25.8 bits (54), Expect = 8.7 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +2 Query: 149 WK-WCGLRRDQTGREGLFR*RGVSERSRQQTLSSVGFGRR 265 WK WC RR+ +R GV R R++ S V +GR+ Sbjct: 90 WKAWC--RRESRRWPSSWRGEGVRWRMRRERRSGVSWGRK 127 >08_01_0133 + 1062365-1063057,1063210-1063318,1063914-1064005, 1064399-1064560,1064718-1064834,1065029-1065127 Length = 423 Score = 25.8 bits (54), Expect = 8.7 Identities = 13/31 (41%), Positives = 17/31 (54%), Gaps = 5/31 (16%) Frame = -2 Query: 258 PKPTELSVCCRER-----SETPRHRNKPSRP 181 P T L+V C +R S+ PR+RN P P Sbjct: 53 PPVTPLAVACDDRHALPDSDEPRNRNPPDHP 83 >07_01_0538 + 3982952-3983297,3983397-3983489,3983627-3983733 Length = 181 Score = 25.8 bits (54), Expect = 8.7 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +1 Query: 244 LCRLRTPSVSRCAWAPGLCGGPDVPAHGSAP 336 +C+++ P +S+C P PD P P Sbjct: 103 VCKVQAPPISQCTAVPTPPPAPDTPTLADEP 133 >05_03_0446 + 14111667-14111906,14112011-14112418 Length = 215 Score = 25.8 bits (54), Expect = 8.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +3 Query: 192 VYSGDGASLSAPGSKR 239 +Y GD AS +APG KR Sbjct: 90 IYDGDAASPAAPGPKR 105 >04_04_0407 - 24983491-24983575,24983655-24984015,24984367-24984406, 24984466-24984468 Length = 162 Score = 25.8 bits (54), Expect = 8.7 Identities = 12/40 (30%), Positives = 20/40 (50%) Frame = -2 Query: 339 GRCRAVSRDIRTTTEARRPGTARNTRRPKPTELSVCCRER 220 G + ++ IRT+ RP T + +R PK +S R + Sbjct: 37 GTAKKTTKKIRTSVTFHRPKTLKKSRDPKYPRVSTPGRNK 76 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,410,321 Number of Sequences: 37544 Number of extensions: 211915 Number of successful extensions: 802 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 801 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 470052804 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -