BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30818 (627 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor prot... 25 2.6 M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles ... 23 6.0 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 23 6.0 >DQ103706-1|AAZ43087.1| 344|Anopheles gambiae pk-1 receptor protein. Length = 344 Score = 24.6 bits (51), Expect = 2.6 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = +1 Query: 460 WEIGFDKVLGQDLRDSTVGIIGLGGIGQAVVKRL---SGFDVARFIY 591 W I + Q L+ G+ GGI Q VVKR+ F+++ F++ Sbjct: 171 WLIAIVSAIPQALQ---FGVTNQGGIDQCVVKRIIIQHSFELSTFLF 214 >M93691-2|AAA29365.1| 1222|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 1222 Score = 23.4 bits (48), Expect = 6.0 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = -2 Query: 350 VSCIPRARNSSGLQWL*PAETVLTIFSCVPAASRISFVIGRLEIQT 213 V + R GL+ L PA+T + S +++F +G +E+Q+ Sbjct: 742 VDQVQRWMQQHGLE-LAPAKTEAVLISSKKTPPQVTFRVGDVEVQS 786 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 23.4 bits (48), Expect = 6.0 Identities = 12/37 (32%), Positives = 17/37 (45%) Frame = +1 Query: 91 ALKILEDHFTVLQSRYLNFGQEGSTLGREEILKLIPG 201 ALKI+ DH VL G + + + K +PG Sbjct: 533 ALKIIRDHLQVLWVNNTIIGFIHKSTAEKYLAKCVPG 569 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 650,077 Number of Sequences: 2352 Number of extensions: 12427 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61050630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -