BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30817 (733 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY119638-1|AAM50292.1| 494|Drosophila melanogaster RE43246p pro... 29 6.5 AE014296-1964|AAO41255.1| 494|Drosophila melanogaster CG6128-PB... 29 6.5 AE014296-1963|AAF50054.2| 494|Drosophila melanogaster CG6128-PA... 29 6.5 >AY119638-1|AAM50292.1| 494|Drosophila melanogaster RE43246p protein. Length = 494 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +3 Query: 375 FVAWTHSNLSLRDILLANNSSGFSTSFLQLYFLN 476 F+AW +++ +RD ++ N+ GF T+ + F N Sbjct: 243 FIAWLYNDSPVRDTVVTNDRWGFGTACMHGDFYN 276 >AE014296-1964|AAO41255.1| 494|Drosophila melanogaster CG6128-PB, isoform B protein. Length = 494 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +3 Query: 375 FVAWTHSNLSLRDILLANNSSGFSTSFLQLYFLN 476 F+AW +++ +RD ++ N+ GF T+ + F N Sbjct: 243 FIAWLYNDSPVRDTVVTNDRWGFGTACMHGDFYN 276 >AE014296-1963|AAF50054.2| 494|Drosophila melanogaster CG6128-PA, isoform A protein. Length = 494 Score = 29.1 bits (62), Expect = 6.5 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = +3 Query: 375 FVAWTHSNLSLRDILLANNSSGFSTSFLQLYFLN 476 F+AW +++ +RD ++ N+ GF T+ + F N Sbjct: 243 FIAWLYNDSPVRDTVVTNDRWGFGTACMHGDFYN 276 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,934,151 Number of Sequences: 53049 Number of extensions: 619147 Number of successful extensions: 1342 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1322 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1342 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3293648160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -