BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30817 (733 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 23 2.2 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 23 2.2 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 23 3.9 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 22 6.8 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 382 RGLIPIYLYAIYFWLIIVLASVHPFFNYTF*IQFRLSFK 498 R I ++++ FWL ++++P F FR +FK Sbjct: 36 RNCIHPTVFSVLFWLGYCNSAINPCIYALFSKDFRFAFK 74 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 382 RGLIPIYLYAIYFWLIIVLASVHPFFNYTF*IQFRLSFK 498 R I ++++ FWL ++++P F FR +FK Sbjct: 484 RNCIHPTVFSVLFWLGYCNSAINPCIYALFSKDFRFAFK 522 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/13 (61%), Positives = 11/13 (84%) Frame = +2 Query: 59 SINWTRGRLLAEI 97 S+NWT G+L AE+ Sbjct: 519 SVNWTIGQLEAEV 531 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 21.8 bits (44), Expect = 6.8 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +3 Query: 168 KRNSKMTVFKNNSQFIFKIVK 230 K+ M + NNS++ FK++K Sbjct: 203 KKGFHMDGYTNNSKWDFKVIK 223 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 210,820 Number of Sequences: 438 Number of extensions: 4915 Number of successful extensions: 11 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22779405 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -